PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000449.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 180aa    MW: 19793.8 Da    PI: 5.2923
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000449.1_g00012.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB159.74.4e-5020115297
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                              ++q+ +lPianv+rimk+ lP nakisk+aket+qec+sefi+fvt+easdkc+re+rkt+ngdd++wal+tlGf+dyv plk yl
  Itr_sc000449.1_g00012.1  20 QDQQLLLPIANVGRIMKQRLPHNAKISKEAKETMQECASEFIGFVTGEASDKCRRERRKTVNGDDICWALGTLGFDDYVGPLKRYL 105
                              5677899******************************************************************************* PP

                    NF-YB  88 kkyrelegek 97 
                              + +re eg++
  Itr_sc000449.1_g00012.1 106 HIFREQEGDQ 115
                              *******997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.8E-4817133IPR009072Histone-fold
SuperFamilySSF471131.71E-3822134IPR009072Histone-fold
PfamPF008082.1E-252689IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.7E-145371No hitNo description
PRINTSPR006158.7E-147290No hitNo description
PRINTSPR006158.7E-1491109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MAENSCAGGS IDEGGSRAEQ DQQLLLPIAN VGRIMKQRLP HNAKISKEAK ETMQECASEF  60
IGFVTGEASD KCRRERRKTV NGDDICWALG TLGFDDYVGP LKRYLHIFRE QEGDQRSVLN  120
NNNNEDSVME EDHLHAPLHS PSSSPGQPST NPVARREAPP PFPAPPHFFN STSYGGDSQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-3720110393NF-YB
4awl_B2e-3720110494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-3720110494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011008710.19e-60PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822486e-49NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLB9N5181e-59B9N518_POPTR; Uncharacterized protein
STRINGPOPTR_0008s22520.13e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.13e-50nuclear factor Y, subunit B5